PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NF-YB
Protein Properties Length: 142aa    MW: 15851.7 Da    PI: 8.0907
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029908genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB156.54.4e-49598497
        NF-YB  4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                 qdr++Pianv+rimk+vlP  akisk+ak+tvqec++efisfvtsea+dkc++e+rkt+ngdd++wal++lGf++y++++  yl+kyr +e+ek
  Lus10029908  5 QDRLVPIANVGRIMKQVLPPTAKISKEAKQTVQECATEFISFVTSEAADKCHKENRKTVNGDDICWALSNLGFDHYADAIVRYLHKYRMAEREK 98
                 9******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-473113IPR009072Histone-fold
SuperFamilySSF471132.8E-385119IPR009072Histone-fold
PfamPF008082.9E-26972IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.0E-173654No hitNo description
PRINTSPR006154.0E-175573No hitNo description
PRINTSPR006154.0E-177492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MDEVQDRLVP IANVGRIMKQ VLPPTAKISK EAKQTVQECA TEFISFVTSE AADKCHKENR  60
KTVNGDDICW ALSNLGFDHY ADAIVRYLHK YRMAEREKAS TSQDRSSNHQ SRQPEHLRGA  120
ATSFEFRVLE KGNSSSPANP S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B9e-39592491Transcription factor HapC (Eurofung)
4g92_B9e-39592491Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023651.17e-72PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040275e-59NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLB9I7Q31e-70B9I7Q3_POPTR; Uncharacterized protein
STRINGPOPTR_0013s02030.13e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.13e-60nuclear factor Y, subunit B4